PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 345aa    MW: 37495.3 Da    PI: 9.1707
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58686379PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-37207PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.1e-1493137347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar   + Rt+ q+ s+ qky
        Lsa017266  93 PWTEEEHRLFLLGLQKLGKGDWRGIARNYVLSRTPTQVASHAQKY 137
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.07486142IPR017930Myb domain
SuperFamilySSF466893.09E-1688141IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-1889141IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-1190136IPR009057Homeodomain-like
SMARTSM007171.8E-1190140IPR001005SANT/Myb domain
CDDcd001675.03E-1093138No hitNo description
PfamPF002493.0E-1193137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGGGVKLFGV RLTDGSIMKK SASMGNLSAL YHSSSPAAVS  60
PNPSSPATSD PVEGYLSDDP SAKRRADRKK GTPWTEEEHR LFLLGLQKLG KGDWRGIARN  120
YVLSRTPTQV ASHAQKYFIR QCSATRRKRR SSLFDMAPDT AAAEPPEDHF MLPPAAATAT  180
ATDHAENSKC SLKLSLKPDS DQSMEMKHEM KEEESSATAT ANVTVTGSEL PPIIPAFYPA  240
YIPVPFPVWP STMTPVEEGN GKGGGANESH HRVVKPIPIL QKEPLNLDEL VGMSSQLTLK  300
ETADHHHHME PSPLTLKLLA EPSRQSAFHA SSGVNKRDGN AFRAV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902398.11e-128PREDICTED: uncharacterized protein LOC107435329
RefseqXP_015902404.11e-128PREDICTED: uncharacterized protein LOC107435334
TrEMBLA0A118K3I00.0A0A118K3I0_CYNCS; Homeodomain-like protein
STRINGGLYMA13G43120.11e-124(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-52MYB_related family protein